GenomeNet

>tr:C1D7V1_LARHH [C1D7V1] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MNRLDNYLNTLNQQRNDQLAGSLRDALQVNPDDYAKTVRLAKAAGVEVEAVPLYADVAQE
AQYLEGIGFRSLWKDSPKTAEFLSDARNARLAHDDVANLSVLEKLARSAGAGLTAANAGL
WGMAQAGTELLVKPVTGALAGLGVLPEDVGGRMGRVVFPDAPDPG

BLAST