GenomeNet

>tr:C3XS89_BRAFL [C3XS89] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EEN69104.1};
MAAYTRDGTDAQLSLPAPYVHDVQRNVRVTEDDTSKKHNKGSTEAAKDGEQSLPWQRRSS
LEKKVKGQVQTKGQAQNGGNTKTIENHVIRMNVSGMHFFTHENILSRYPDTLLGDASRRK
KFYCKDYDEYFFDRHRPSFEGILFYYQTGIMKRPRNVPVEIFVMELKYFDMGDSVIKDLL
KNEGCYVPDEELEPQNRIKRIIWDLFEQPESSAGARIVAVLSFLFILISVAETCVETLPQ
FRTTDADLLNISDMLTNSTEPPTNTTASKSLEETISQLQSAFQNPFFCVETACVVWFTLE
LAMRFYACPSKAAFAKKLLNIIDFAAILPFFVTLVLIVFATSRERAALSLVVLRILRLVR
VLRILKLSRHVKAMRLLAVTVYESRHALGSLFLFLMIGVVTFATGIYVTEEYVPETFFTS
IPDSFWWAIITMTTVGYGDTYPQGGAGKLVAVFSFFFGILIMAMLMPIFVDKFNAMYVYE
MTNPYRAINDLKPEPEDTPENTEKIEQRETSL

BLAST