GenomeNet

>tr:C6JJ61_FUSVA [C6JJ61] SubName: Full=NCS1 nucleoside transporter family protein {ECO:0000313|EMBL:EES64679.1};
MNSENEKLRSKELLPTGSKERDMSLFDYIILWAGMTINIVAFSLGAQYYNGGKGLSPWTL
VCVMLIGYGIVTLFTSLVGDIGTKYGVPFAAYIRAPFGYKGANIAGFIRAIPGLYWFGFL
TWIGAGSLNKIMAIIFPGFDNLMLMIIIFAAVQVLNTMYGLKAMAKFGWIAIPSLAVMFT
AILIGTLNKYNITIPEIMSIETEGGYSFAFAIAGIAGGWLTMALNGSDLTRQIKRYENYE
NMNFFQRNKRAIFGQVVGLMIVGVVTMLIGVASGITSGFWDLNDVVPDLFANNNITLILC
FIVIVFAQWSTNTAANLLPPALVLLNFSPKIKYWMSTIICGTISIGIMPWKIQSSGGFLV
DIQSWISQMLGPIIGIILTDYFIIRKCQLNVKDLYTAGGQYEYTNGYNISAIIALFIAFF
IGLLFGDYAFFVGSIVSVIVYYVLMKCITLKKYNQNIGKEIFFDSSIN

BLAST