GenomeNet

>tr:C6XR65_HIRBI [C6XR65] SubName: Full=Phage shock protein A, PspA {ECO:0000313|EMBL:ACT60596.1};
MGIFSRFGDIINSNLNAMLDKAEDPEKIARLIIQEMEDTLVEVRTAAARTMADKKELQRE
MRELQIVRDDWSAKAELAIEKDREDLARGALSAKQRAEREIESRKSALAAVDDAAAKRQD
DLGKLQAKLEEAKTKHRALMVRRQAAEERIKVRSRIDDSKVDDALHRYAAVERKVDELEA
YADTYDLKSKTLESEFADLEASESVELELAAMKARKKSGSDN

BLAST