GenomeNet

>tr:D1PM06_9FIRM [D1PM06] SubName: Full=DNA-binding helix-turn-helix protein {ECO:0000313|EMBL:EFB76271.1};
MKGATSIQERLWELRKDKGLNLEELSKLTGISKSALGSYEKEDFKEINHGNLITLADFYG
VSVDYLLCRTENKEQINTPLTELHLNDEMVALLKSGRINNRLLCELATHKDFIKFLADIE
IYVDGIATMQIQNLNALVDTVRHEIIERYRPGEDDPHLKVLQAAHISDDEYFSHMVLDDL
NLIIRDIRESHKKDSESAPQTTVADELKENLEAVENFKGSRLEKLAMLYCKQLGINYKNL
SEEEFRWLIRILQKSKKMGTPISQRKKW

BLAST