GenomeNet

>tr:D3V905_XENNA [D3V905] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CBJ89203.1};
MKVSTFVASIALAGFCFVANASTLDRVAVYSTEKSNGSVSVGGKNAYTKSFEVAVANLSD
KDIDLSKLCLKAYSPDKKEFRLDTVDEDLNQGTLKAGKSVRGIAVLASENDVVHKAALIK
ISADCK

BLAST