GenomeNet

>tr:D4JDK7_9FIRM [D4JDK7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CBK88279.1};
MNHYDVTIRETLEVKMKVAANSREEAEQFARDQWKRGEVVLDASHFTGVEFHAKRYFRDR
GER

BLAST