GenomeNet

>tr:D4X4B8_9BURK [D4X4B8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EFF78355.1};
MRIRVAIALSVMFLSGCAMTSGPAPAAEGAKTRAEVRADLAMWKRAGMNKFYKGRHTPDI
YSASYRKSYANYLELRNGPEYQEELNRLKGEEQ

BLAST