GenomeNet

>tr:D8QDE9_SCHCM [D8QDE9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EFI93666.1};
MFKKPLGHLKTSSALRSSDRRKLKQRVISTFGCSAEDGDVLVPEGIQSIKFTTHMDAPGV
AYLDADDTPLWFSLGKAGDDLIPTVYTLWKRPELLPFVTTPSQVISILIGGADLMRPGVT
SYIPGLQKGQLVAVRRLIGGASPKVSPPLAVGHMALSSDELKEDHKGKAVLITHTWKDHL
WEMGPKTEPPEDTPLTAPTADVGDANGSSKEPDATPTLKGPVYTPAEVSQLLHLALVQSI
ATSPPSSFPVPSNTFYASHVLPSRPAFPDLVLPPATSPANLDSAALRQEISLKTSSHKSL
AAFLKAAEKAGLLTVKATPKQKNDVMVTSVNTTHPDVTTHRQFPTVREVEEREAKREARK
EELSAKEEARGSMLEATELWKPHMHTVPLFVDWGLSTSEQYTFPELKRIFNNWLEAHPEA
INPHERAYISLKVPAASSLVAAAYPPNKKGTPPAPEFAKREDILRDLIKQMQPWYEVKHA
NGERVTRKKGTLKPVNVAHKIRQGRKAATIITGFEPFEMAVNSEEMAEDLRKICASATSV
APGPNKQLEVLVQGKQAKTVVEYLVKKGIPKNWIQTEDQTKGKK

BLAST