GenomeNet

>tr:D8U5D0_VOLCA [D8U5D0] RecName: Full=Serine/threonine-protein phosphatase {ECO:0000256|RuleBase:RU004273}; EC=3.1.3.16 {ECO:0000256|RuleBase:RU004273};
MDIAQVDEIIERLLDVRNGRPGKQVQLAENEIRLLCLTAKEIFMSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLSFKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIRLWRTFTDCFNCLPVAALIDEKILCMHGGLSPELKSL
EQIKRITRPTDVPDSGLLCDLLWADPDKDIQGWGENDRGVSYTFGPDCVTEFLQKHDLDL
VCRAHQVVEEGYEFFAKRQLVTIFSAPNYCGEFENAGAMMSVDETLMCSFQILKPAETKQ
KGRR

BLAST