GenomeNet

>tr:E3RXS0_PYRTT [E3RXS0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EFQ89485.1};
MKTLAGLSWISALSSLATLPNGFGVSAQNNTPNAWPLHDNGLNNVVQWDHYSFKVNGKRL
FVFSGEIHYWRIPVYEVWEDLLEKIKAAGFTAFAFYGNWAYHSANNQTLDFESGAHDFSK
LFEIAHRVGLYVITRPGPYVNAEANAGGFPLWLTTGAYGKLRDDDPRYLQALDPYFSKFS
ELTSKHLVTNGGNALVYQIENEYGEQWKDRTKKIPNDVAARYMQALEDSARSNGIEIPLI
HNDPNMNTKSWSKDYAPGAVGNVDIAGLDSYPSCWSCNLAECTGTNGKYVAYQVVNYYDH
FKEVSPTQPSFFPEFQGGSYNPWGGPEGGCPGDIGADFANLFYRNLISQRVTAVSLYMMF
GGTNWGAIAAPVTATSYDYSSPISENREIGAKFYETKNLAMFTRVADDLTITDRLGSSSS
YTTNSAVTASELRNPITKAAFYVTIHSVSSSSTTESFKLHVSTSVGNLTIPQHSGSIVLN
GHQSKIISTDFAMGNKTLTYSTAEILTYALIDFNPVVVLSTGVGESVEFHVKGATKGSLA
SSGSTSNATFRVEAGGVTTNTERVYGMSVYQFDNGVKVVVADKPTAYLFWAPNLSNDPFA
PVDQSVLVQGPYLVRATALDGDVLALKGDVKNSTTIEVFVHETAHTLSWNGKKLETLRTP
YGSLKAHVSAFDGTISLPSLNDWKVNEGLPEKMPEYDDSGAAWVVANHTTTPNPTKPDTL
PVLYVDEYGFHNSFHLFRGYFEGSAKGAQLSVQGGLAFGWSAWLNGDLVGSWLGNTTLGV
GNMTLSFANATVHANDTNVLLIAQDNTGHDLRGGATNPRGILRATLDGADFTSWKIAGEA
GGEDIQLDPVRGPLAEGGLTAERLGWHLPGFSDGNWASASPSTGFSGADIKFYRTTFPLD
VPKDVDASFAFILNATGPKTVRVQLFVNGYQYARFNPYVGNEIKFPIPPGILNYAGDNVI
GLSVWAQKDDGAKIDVQFVQEYAVESSWSSRFDSEYLRPKWTEERLAYA

BLAST