GenomeNet

>tr:E6TYM4_BACCJ [E6TYM4] SubName: Full=Manganese/iron superoxide dismutase-like protein {ECO:0000313|EMBL:ADU30074.1};
MLDVNDYIEKLKEWLNDFEEQLHQSDGLSENFVDEVKGLQNKLSREEDHGKLGKIQYEAE
QLYDRYINSRAVESRNENDGESKRVAIGEHTLPRLNYQYHDLEPYIARRIMELHHKKHHQ
SYVDGLNKAEKELQRQRERNHFELVKHWERELAFHGAGHYLHTLFWKVMTPKGGGQPNGA
LLKQFVLDFGSFEAFKAHFSEAAKNVEGSGWAILVWSPRPGRLEVLTAEKHQNLTQWDVI
PLLPLDVWEHAYYLQYENKREDYISNWWKVINWPYVQQRFNEVRNNVSIV

BLAST