GenomeNet

>tr:E9SBG6_RUMAL [E9SBG6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EGC03373.1};
MKEFNVTIIETLKRTVTVEAETAEDAKDMVDAAWHNSEYILEAEDFDGVEFTVQNEKDGV
EIEEINVEDNSIDTSKDRPYDSLYDMYYDEFDDYEK

BLAST