GenomeNet

>tr:E9SC95_RUMAL [E9SC95] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EGC03093.1};
MKEFNVIITETLRKVVTVEAETAEDAEEIVDAAWHNSEYILEAEDFDGVEFTVQNEKDGV
KIEEINVEDNSIDTSKDRPYDSLYDMYYDEFDDYEK

BLAST