GenomeNet

>tr:F0GHG0_9BURK [F0GHG0] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MSRFNIFLLIIVMGCALSVVNSTNQQRQIFIQLQRAQSQERQLQQDYAQLQYQQSALSKT
SRIEQLANDSLKMQPITTGRTQYLTLPPGAAKAIDAPIPASADTAGKGKGGAR

BLAST