GenomeNet

>tr:F0ZGZ2_DICPU [F0ZGZ2] RecName: Full=PlsC domain-containing protein {ECO:0000259|SMART:SM00563};
MVVISNFYEGKNVLITGSTGFVGKVLLEKMVRDLPGIQKIYIIIRGNAKERFIDDIIGSR
IWDLLKAKLGGEEEFNKLIHNKVVPVSGDLSKEGLGLSPEDTQTIIDNVNVIIHCAASID
FRERLDKAIQSNLYASLNMLDLSRKLRNIKAYVHCSTAYVNSNREGWLDEELPVLDFNPE
EMVDLIMKQDIQTLERITPNLLGAYPNTYTFTKAITERILALKRGDVPLCFVRPTIVGGS
LKEPVPGWVDSVAAIGAVMLYCGVGLVQFMKGDGRMVADIVPVDHVANALIAAAVSMESQ
NSLKIFQIGTSHRNPVLWNRISHYVTEYWRSHTPKKSVARSSFSFHSHIMYEAHFFMKYG
IPSALLQVLAVLTGSEDTKTKAEGFKKITKAARLICDTFKHFTGHEWVFSVQTLEKIFQD
LFDGEDRIKFNCDAAEINWQSYFCYFCYGLHKYVIKEEGVRPPTELLNTSIITKSEVNQS
GFFQWVFADISWASTSYRHVTQTPLPPRAPTEIRSLVMNSPRVQQAMEKVSREEGVLVSE
IEKRASQIMDRMQSNLNIMVVRVLGWFLKKVWRKIYQGIHVDEKGIELIREAIKKSPVVL
IPSHRSYIDFLIISYIFFEYNLPLPHIAAGEDFLSIIIVRWFFRNAGAFFLRRTFHGDSL
YWAIFSEYVQRLVIDNQPMEFFIEGKRSRTGKSLHPKMGLLSMVCQPYFENRVQDVHIVP
IGISYEKVLEGELYSNELMGESKTKESLNGLLRASKVLKMNFGRINVVFTPPISVKQYTE
QKVQEVASQRHLPAPALPAPSILSTPASIAPPSSTKNSNISEGDFEINFNKPDSRATGAI
YDPFNNNGDRRSLISDLGYQIVRDLNKSIIITTTSVVATILLSFRRGINREELITKVEWL
REEIFARGGDVAFEGPSDALVDHSLKLISNLVSKRRNMYEPGSAQLGVTNKNYRKNVLVL
NFYRNQLLHLFLWDGLVSLVILSILQTRDQQSNENILNTNNVNNKQPKDTVSEETIICEV
RFLAKVLSIEFVNQPGYDTDEFIKGQINRMAIRGIINKEQTNEQTFYGVKSEGACSFFAN
LFYPLVEGYLSGILTLFSIQPEMMIKKNQFLQRMGWFAEKMFEEGKSNFYESCSMEILGN
SLQLFEQMKVIQRKKLEEQVGKRTTRSSNGNKKQQKKPTRRERKQEPEEYIRLLPPYQDK
DGLLKELTERLSKYKKSPQTKHQLNDLRRTVVEDFPLLSSKL

BLAST