GenomeNet

>tr:F2DE43_HORVV [F2DE43] SubName: Full=Predicted protein {ECO:0000313|EMBL:BAJ93364.1};
MGSIGTTNGNGIGHGSAAMAAPAWRQHAHAEGPAAILGIGTANPTGVEIPQDIFAENLFR
VTKSDHLTHLQHKLTRICEKTGIDKRHFHLTEETLVAHPELYDHEAPSLDNRIAMTVDAV
PKLAQRAADKAIADWGRPASDITHLVFSTYSAWGAPSADLRLATLLGLRPTVSRTILSLH
GCYGGGRALNLARELAENNRGARVLVACAEITLVCFGGPDGGNLVGHALFGDGAGAVIVG
AGPFRDGEQSPIFEMVHATQTTLPKTEHALGMQVSGSGVDFHLAIQVPTLIGQNVERCLL
HAFRGGDDDDGDGGAARLPCPLSGNGKWNDLFWAVHPGGRPILDNIDKVLELEPEKLAAS
RHVLREYGNMSGATIVFVLDELRRRRSMLPEWGAMLAFGPGVTIETMVLRCPR

BLAST