GenomeNet

>tr:F2KEF7_PSEBN [F2KEF7] SubName: Full=Putative peptide synthase {ECO:0000313|EMBL:AEA67873.1};
MTDAFELPITLAHALQRRAALTPDRVALRFLADTPGQGVVLSYRDLDLRARTIAATLQAE
AALGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSILKDAEPRLL
LTSSDLREPLQAIESAPPVLCVDTLDPARAGQWRMPTLQDDDIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRHGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPVFSGVPCVLMSPAY
FLARPLRWLEAISEYGGTISGGPDFAYRLCSERVSDSALQRLDLSGWRVAYSGSEPIRLD
TLERFAEKFAPCGFTPDNFMASYGLAEATLFVAGTPRRHGIPSLRVDDAALTQNRAEPGQ
GSAVMSCGVSQPGHAVLIVEPATLQPLADNQVGEVWAAGPSIALGYWRNPEASAKTFVQH
DGRTWLRTGDLGFLRGGELFITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAF
AVNDGGEEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQQAPSVVVLLNPGALPKTS
SGKLQRSACRSRLADGSLDSYAQFPSAEAEVADESAPSSELQTLIGQIWREQLQVEQVQA
DDHFFLLGGNSIAATQVIARLRETLGLELNLRLLFEAPTLAAFAAAVANQQQDGGQPQGA
ISALSRDDALPQSLAQNRLWFTWQLDPTSHAYNIPGALHLRGELDEDALRASFQQLIERH
ESLRTRFLERDGVALQQVDPAGEFKLHVIDLGDLPADLREARARQVREDEAATPFDLEKG
PLLRVSLLRLDEDDHQLLVTLHHIIADGWSMNVLIEEFSRLYAAASQGQLAELAPLPLQY
ADYGSWQRQWLAQGEAEHQLRFWKQQLGAEPSALVLGTDHPRSAQRQRSAARHSLRLDKG
LCDTLRHVAQAHDATPFMLLLAAFQALLQRYTGQSDIRIGVPNANRPRLETQGLIGFFIN
TQVLRGQVDSRQPFAALLAQAREATLGAQVHQDLPFEQLLEAFPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLTLSFDYADELFEAATIERLA
AHYCNLLRAVCADPQQTIGDVPLLAADEHSQQQQWSAAPCAPASQWLPELLNEQARCTPQ
RTALRWDGGQLDYAELHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGVLAVIKAGG
AYVPLDADYPAERLAYMLHDSGVDLLLTQTELLERLPVCDGVSVIAMDALHLEQWPSNPP
GLHLHGDHLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYGLDATDVLMQKAPISFD
VSVWECFWPLITGSELVLAGPGEHRDPHRIAQLVQQFGVTTLHFVPPLLSLFVDEPLSAR
CSSLRRLFSGGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCTEADGERSPIG
RPLGNVLCRVLDSDLNPVPAGVPGELCIGGLGLARGYLGRPGLSAERFVADPLGPAGARL
YRTGDRARWNADGVIEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGIAQVAVLVRDTSTG
PQLIGYYTAPDVAQDQDALNIRLKAALAAELPDYMVPTQLLRLDAMPLGPSGKLDRRALP
EPQWQVREHVEPASALEQQIAGIWREVLGLARIGLRDDFFALGGHSLLATQIISRTRQAC
DVELPLRTLFEASELGAFAEQVRLIQASGQANRQPPIEKVDRSQPVPLSYSQQRMWFLWQ
MEPDSPAYNVGGMARLRGVLDVGRFEAALQALILRHETLRTTFPSVDGVARQQVHGETGL
RMGWKDFSKLAADVREQRVQQLADSEAHQPFDLETGPLLRACLVKTAEHEHYFVLTLHHI
VTEGWAMDIFARELSALYEAFIDDRESPLEPLPVQYLDYSVWQRQWLESGERQRQLDYWT
AQLGREHPLLELPGDRPRPSVQSHRGELFRFDLSDDLAARVRAFNAQQGLTLFMTMTAAL
AVLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVGELFEQVRHT
VIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEYLVNDA
RATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAGHWRNLLEALLVDPARRLSELP
LLDTREQQQLLDSLGVEPGEHRLDQCLHELFDEQARMRPDAPALTFAGQTLTYAQLNSRA
NRLAWMLRERGVGPQVRVGLALERSLGMVIGLLAILKAGGAYVPLDPEYPLDRLSYMIED
SGVSLLLSDRAMFHALGALPEGVGCWCLEDDSAALAQYPDQPLPLINLPQHQAYLIYTSG
STGKPKGVVVSHGEIAMHCQAVIQRFGMRPDDCELHFYSINFDAATERLLVPLLSGAHVV
LRAQGQWDAEEICGLIRQHRINILGFTPSYGSQLAQWLATQGQTLPVRMCITGGEALTGE
HLQRIRAAFNPSLFFNAYGPTETVVMPLASLAPERLEEGAASVPIGSVIGARVAYILDAD
LALVPQGATGELYVGGAGLAQGYHQRPGMTAERFVADPFANEGGRLYRTGDLVRQRADGL
VEYLGRIDHQVKIRGFRIELGEIETRLLEHDAVCEAVVLALDTPGGKQLAGYLVSDLASQ
DGEQQATLREALKNHLKAQLPDYMVPAHLILLASMPLTANGKLDRRALPLPDPELNRQHY
VAPSNALEQTLAAIWCDVLNVGQVGLNDNFFELGGDSILSIQVVSRARQQGIHFTPRDLF
QHQTVQTLAAVATRSQQVLAEQGLLQGESGLTPIQHWFFERQIPNQHHWNQALVLAPTTA
LEPQPLEQALRSVFQHHDALRLGFGETAGHWRAEHQPLSDAALLQHISVATAQDCEALFA
QTQSRFNLSTGPLLRAVLAQLPYGQQRLLIVIHHLVVDGVSWRVLMDDLQTVYRQLTTGQ
QVQLPAKTSPLRDWAARLQAYAGSESLREELEWWQVQLSGAQLQLPSANPEGGLQERHAE
TVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALTRVLCRWSGHASALVQLEGHGREALF
DDIDLTRTVGWFTSVYPVRLSPADEGFGASIKAIKEQLRAVPHKGLGHGVLRYMADAATR
QTMANLPRAAITFNYLGQLDQTLGQDALFQPLDAPLGAIHDPDAPLPNELSVDSQVSGGE
LVLRWTFSRERHDRQAIATLAEAYLDELQRLIEHCLTDEAGGLTPSDFPLAKMTQGQLDS
LPVPAGQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPQRFAQAWQAVIA
RHEALRASFCWNVGEDMLQIIHRPGRTPVDYLDWSEVPEDAQEAKLQALLKSERQAGFDL
LNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMDDFFEIYTALGENREPQLTVPP
RYRDYIGWLQHQSLAEARQWWQRNLKGFERTTPIPGDRPFLREHAGDSGGMIVGDCYTRL
DVEDGARLRELAQAHQLTVNTFAQAAWALVLRRVSGDRDVLFGVTVAGRPVELPQMQRTV
GLFINSIALRVQMPEDHQRCSVRQWLSDLLDSNMQLREYEYLPLVSIQEVSELPKGQPLF
DSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDE
STVQGLLGEFKRLLLALMAGLHGDMSELPLIGAEEQDFLIEGCNQSEHAYPLEQSYVELF
EARVAAHPQRPAVSCLDASYSYAELNARSNRLGHALIASGVGLDQPVALLAERDAELLGM
IVGSFKAGAGYLPLDPGLPSQRLSRIIELSRTPLLVCTQACEAQAQALLDEFACSGRPKL
LVWEAVQASALSLENPGIYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLA
LSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNAIAHDPQGLLEHVQQQGISVLES
VPSLIQGMLAQERIGLDGLRWMLPTGEAMPPELAHQWLLRYPDIGLVNAYGPAECSDDVA
FFRVDLASTRGTYLPIGTPTDNNRLYLLDGALDLVPLGAVGELCVAGTGVGRGYVSDPLR
TAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRGYRIELGEIEARLHE
QPEVRDGAVGVQEGANGKHLVGYLVATDSALKSAERLERIKQRLRAELPEYMVPLHWLWL
ERLPLNVNGKLDRKALPTLEIGQLQSQDYQAPGNELEQTLADIWAQVLKVERVGVRDNFF
ELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVQELADYIDGLAASEITEEKVDRLND
LMAELEGM

BLAST