GenomeNet

>tr:F6EUZ7_SPHCR [F6EUZ7] SubName: Full=Glutathione S-transferase domain protein {ECO:0000313|EMBL:AEG47921.1};
MPHAITLYTNPMSRGQIARWMLEEVGQSYEMVVLDYGEGGMKSADYLAINPMGKVPAIVH
DGRTITECAAICAYLADAFPAANLAPPTDQRADYYRWLFFAAGPVEAAVTNKALGFTVPE
NRERTAGYGTFDHMVDTLERAVSGPAWICGDQFTAADVYVGAQIDWGLSFGTIPSRPAFE
AYASRLRERPAYRRQKDMDNALIAQMQKSA

BLAST