GenomeNet

>tr:F6TFD4_MONDO [F6TFD4] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000000237};
MTKALVIDKINQDYEKNGKNHRTSALTQDRLVLRRGQSFSISLTFHGRGFEASTDKLFFL
VETGPRPNETVFTKAKFPLSTTHSEGSWEASMVSQEGHTLNLAFSSPANAPIGYYKLSME
SITGSQHHISSITGFVLLFNPWCKEDSVYMEEEEFRQEYVMNQHGLIFQGAPACIEKIPW
NFGQFEDGILDICIELMDMNPKFIRDCGRDCSRRNSPIYVSRVISAMVNCNDDKGILFGR
WDNNYKDGINPMSWIGSVDILKKWKKSGCCQVKYGQCWVFAAVACTVLRCLGIPSRVVTN
YNSAHDSNANLVVDLYTDEKGMTVKHSNESIWNYHCWTESWMTRPDLKPECNGWQVIDPT
PQEKSEGAFCCGPASVNAIKNGDVNTKYDAPFVFAEVNADVVKWIKKSNGTTEKAYTETT
IVGMMISTKAVGKDEREDITHLYKYPENSKEERESFKRANHMNKLGCRDDPSSDEKLKIK
IKVSPDMNKGNDFDVFAMIKNGFSEEQTCHLLIMARTMSYNGILGPECAKKEMHSVTLEP
LSEKKIPLRISYANYRDHLNDSNLIKVQVFLQHLQSQFFFLSERDIYLLNPEIKIRILGE
PKQFRKLVAELSVKNPLHVPLHDCAFTVEGAGLTQGQKIARVPEPVEPGNTVTTRMDLMP
RWPGLHKLVVNFESDKMKAVKGYWNVIIG

BLAST