GenomeNet

>tr:F6Y932_XENTR [F6Y932] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MASLFRSEEMSLTQLILQVEAGYCCIAELGELGLVQFRDLNASVNSFQRRFVNEVRRCEN
MERILPLIESLAQQVQGVLMLVNQAPVXPYPDPTIPYRAPHNNILGQHRAGLEPPRRGWL
RSVSVLYMGPCVLQAEANLPDDFFSEDTSSLLELRTIPSAAAAGKLGFTAGVINRERMAT
FERLLWRVCRGNIYLKYTELDTALEDPVTKEEVKKNVFIIFYQGDQLKLKIKKICDGSVT
GILCQMKKISNSKXTIAPILTNISSKLDPPTFNRTNKFTSGFQNIVNAYGVGSYREMNPT
PYTIITFPFLFAVMFGDCGHGSVMLGFALWMVLNEKQLLASKTDNEIWNTFFGGRYLILL
MSIFSIYTGFIYNDCFSKSFDIFGSSWRVRPMFINKTWNDNLVHQGLQLQLDPAVPGVYS
GNPYPFGIDPIWNIAQNKLTFLNSYKMKMSVVMGITQMVFGVMLGLLNHINFKRPINIIL
QFIPEMIFIICLFGYLVFMIIFKWCKYDVHSSQGAPSILIHFINMFLFNYSDPTNAPLYE
HQKEVQTFLVIFALIAVPWMLLIKPFVLRANHLKAQRMGVINFWKLQSSSGPEDHAELTD
VENAHANHKSKKEFDFGDIFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWT
MVMHQGLSIGGYGGLIGVFIIFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYAG
TGHLFSPFSFQSILEGTDNE

BLAST