GenomeNet

>tr:F8D4P7_HALXS [F8D4P7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AEH37516.1};
MGLGSTAKKIQGLSERAEAMYKQVQKLQERIISLEEEMDDTHDTVNRIDHQLTEQRALLL
AIAEEQGIDGEEILAQAAIDEAELEDADDESEATDGESASADGGETTAE

BLAST