GenomeNet

>tr:G0QWM5_ICHMG [G0QWM5] RecName: Full=Serine/threonine-protein phosphatase {ECO:0000256|RuleBase:RU004273}; EC=3.1.3.16 {ECO:0000256|RuleBase:RU004273};
MVDKNLKQVDIDVDNIIEKLLSCREYKPGKLANLTETEIRGLCIKSREIFISQPILLELE
APLKICGDIHGQFYDLLRLFQYGQYPPDANYLFLGDYVDRGKQSLETISLLLAYKIKYPE
NFFLLRGNHECASINRIYGFYDECRRRFNIKLWKTFTDCFNCLPVASIIDEKIFCMHGGL
SPELTNLEQIRRIVRPIDVPDTGLLCDLLWSDPDKDVQGWAENERGVSYVFSPEIVSVFL
KKHELDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAAAVMTIDEQLMCSFQVL
KPADSKSGK

BLAST