GenomeNet

>tr:G1X792_ARTOA [G1X792] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EGX51000.1};
MRLRKFNLQLDPLPATYAPSNKWSNKDMDPVPLDMRTWRWWHIVAYWISDAFNVPTWQLA
SAMIAVGLGFKASIAAIVVGQLFISIPMTLHGYIGAKLHIPFPVLARSSFGFYFSYFAIV
SRVVLACFWFGIQTTTGGNCVREMIKAIWPSFASFPNHLPASSGATSQSMLCYFIYWVIQ
FPFLLVHPSKIRYLFILKSILTPACGISLMAWAFHKTGGGPIFSNPATLTGSAAAWQWLT
GLNSVLGQWSTLAINIGDFTRYARSPREQYVQPFVIPLAFTFIAFMGISVTSASKIIYGE
YHWDPLQIIALWGNSPGERAARFWCAFSFTLATLGTNIAANSISAGNDFNALLPRYLNIK
RGSILCAFIGGWVLVPWYILASAPRFLGFAGGYTVFLAPIAGVMTSDFYLVKKRKVSVPA
MYRPKSIYSYWHGINWRALAAMFVGCIPCFPGFLHNINPAIGNKNVKYMFSISWLYGYFT
TAAVYWALSKLFPDTRSLLDSMIYEEDDDNLQDHESIEGVGSDGAPEKRDESTPKGIEAG
F

BLAST