GenomeNet

>tr:G2LLK8_CHLTF [G2LLK8] SubName: Full=Periplasmic protein involved in polysaccharide export {ECO:0000313|EMBL:AEP13804.1};
MLYLALWLLALPGLAGFSFAQETAPNPPSFPPVMPSPAVRATQVYTAPTGDYVIGPGDVV
DIKVFKQPDLTGRFRVGDSGSVELLFIGKQQLAGLTESEAADLLRQELRKYLRQPEVSVT
VTEFNSRLVTVIGAVRTPGRQPLRRAMRLLDVIALAGGLAEDSSRFVNVIRYVSKPAEEA
QPALGAAPTPEPDEDVPPDVEILSINIDDIIAGNAKNNLLLQPGDIISVPRADVVYLAGN
VRKPGPITARNPITVTQAIAMASGLAEGAKRNDIRLYRTVPGKLEREEIKISLAAIQSGK
QKDLVLQANDVLYVPHSELRSAGTTVMRSLPTLVTSALIPLLTTAIIR

BLAST