GenomeNet

>sp:SLIT1_CAEEL [G5EFX6] RecName: Full=Slit homolog 1 protein; Short=Slt-1; Flags: Precursor;
MLICFIFILLIPESATCPAECVCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDNEITKIG
PNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTH
LDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVSLEVLTLNGNRLTTFE
EPSNARFRQLDLFNNPWNCDCRLRWMRKWLEKAEGQNKTVCATPLNLQGSSIEILQDKFM
TCSGNRKRRYKKTCETAEICPLPCTCTGTTVDCRDSGLTYVPTNLPPSTTEIRLEQNQIS
SIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGS
LQLLLLNANQLTCIRRGTFDHVPKLSMLSLYDNDIKSISEVTFQNLTSLSTLHLAKNPLI
CDCNLQWLAQINLQKNIETSGARCEQPKRLRKKKFATLPPNKFKCKGSESFVSMYADSCF
IDSICPTQCDCYGTTVDCNKRGLNTIPTSIPRFATQLLLSGNNISTVDLNSNIHVLENLE
VLDLSNNHITFINDKSFEKLSKLRELRLNDNKLHHFSSMVLDEQSNLEILDLSGNNIQCF
SSIFFNKATRIREIKVIGNDLLCDCRILPLMSWLRSNSSHSIDIPPCQQFQYSDNESDKQ
RCAAFPEETCSDDSNLCPPKCSCLDRVVRCSNKNLTSFPSRIPFDTTELYLDANYINEIP
AHDLNRLYSLTKLDLSHNRLISLENNTFSNLTRLSTLIISYNKLRCLQPLAFNGLNALRI
LSLHGNDISFLPQSAFSNLTSITHIAVGSNSLYCDCNMAWFSKWIKSKFIEAGIARCEYP
NTVSNQLLLTAQPYQFTCDSKVPTKLATKCDLCLNSPCKNNAICETTSSRKYTCNCTPGF
YGVHCENQIDACYGSPCLNNATCKVAQAGRFNCYCNKGFEGDYCEKNIDDCVNSKCENGG
KCVDLINSYRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPINGSYSCMCSPGFTGN
NCETNIDDCKNVECQNGGSCVDGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSA
CGQGECVASQNSSDFTCKCHEGFSGPSCDRQMSVGFKNPGAYLALDPLASDGTITMTLRT
TSKIGILLYYGDDHFVSAELYDGRVKLVYYIGNFPASHMYSSVKVNDGLPHRISIRTSER
KCFLQIDKNPVQIVENSGKSDQLITKGKEMLYIGGLPIEKSQDAKRRFHVKNSESLKGCI
SSITINEVPINLQQALENVNTEQSCSATVNFCAGIDCGNGKCTNNALSPKGYMCQCDSHF
SGEHCDEKRIKCDKQKFRRHHIENECRSVDRIKIAECNGYCGGEQNCCTAVKKKQRKVKM
ICKNGTTKISTVHIIRQCQCEPTKSVLSEK

BLAST