GenomeNet

>tr:G8YGW8_PICSO [G8YGW8] SubName: Full=Piso0_002997 protein {ECO:0000313|EMBL:CCE80670.1};
MGYSSERIDAMEGIERRNEKDLEKRISYESFEKTESGTQADVKAVKLTFVQRLASMMNAE
IKGIEPVTDEEKVEHSLVNAGTMWLSADLVIATFSLGALGITVFKLSFWQAFLVIVFFSL
LGALPVAFFSIFGPKLGLRQMILSKFLVGDYGMRIFALINMVACVGWGAVNIMSSAQLLN
IVNNGACPPWAGCLILIVCTIIVTFFGYHIIHLYEKWSWVPNLVVFIAIIARMAKSGNFT
YGDMKGGATTAGDVLSFGGTIYGFATGWTTYAADYTVYQPRNANSYKIFFSILAGLLTPL
IFTLTLGAACATGTLTDDKWAKMYADKSIGGLVYSILVVDSLHGFGQFLCVILALSTVAN
NIPNMYSIALSAQAFWSQLSRIPRVLWTICGNFVTLAICIPAYYHFESVMGNFMDIIGYY
LAIYQAMCLSEHFIYNRGSFAKYDWDRIYDKTAYPMGIAGIFGFCCGAAGVVVGMSQNWY
HGVIGRRIGKFGGEIGFELAFAFAFIGFNIVRPLEKKYTGR

BLAST