GenomeNet

>tr:G9NAI9_HYPVG [G9NAI9] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MAPRKDTPFRSAEMSMVQLYVSNEIGREVVTALGELGLCQFRDLNEDVSAFQRTFTQEIR
RLDNVERQLRYFYAQMEKAGIPLRKLDLDAEKLASPSTSEIDELAERAQKLEQRISALND
SYETLKKREGDLSEWRWVLREAGSFFDRAHGNVEEIRASTDNDDAPLLSDIEQHNTAPDV
ERSFSGMNIGFVAGVINRDRVAAFERILWRTLRGNLYMNQSEIPEPLIDPTNNESIQKNV
FVIFAHGKEILSKIRKISESMGANVYNVDENSDLRRDQIHEVNNRLEDVQNVLRNTQATL
EAELNQISQSLSPWTVLIAKEKAVYSTLNLLSYDSARRTLIAEAWCPTNDMPLIRSTLQD
VTNRAGLSVPSIVNEIITNKKPPTYLKTNKFTEGFQTIVNAYGTATYQEVNPALPVIVTF
PFLFAVMFGDLGHAIIMLSAALAMIYWEKSLKKVSFELFAMIFYGRYIALVMAVFSVFTG
LMYNDIFSKSMTLWGSAWEYEHPEHWTEGMPVTAVLNDKGYRYPFGLDWAWHGTENNLLF
TNSYKMKMSIILGWAHMTYSLCFSYINARHFKKPIDIWGNFIPGMIFFQSIFGYLVVCII
YKWSVDWNAVGKAPPGLLNMLIYMFLQPGKLDERLYAGQEYVQTILLLLAFVQVPILLFL
KPFYLRWENSKTRARGYRGIGETSRVSALDGDDESEALVNGHGNSFDEGEGVAMISQNID
DEHEEFEFSEVMIHQIIHTIEFCLNCVSHTASYLRLWALSLAHQQLSVVLWDMTIGPCLA
TGGVLGVIMIVIGFYLWFFLTIAILVCMEGTSAMLHSLRLAWVESFSKFAEFNGWPFAPF
SFNTLIEESEELKNYLE

BLAST