GenomeNet

>tr:G9Z376_9ENTR [G9Z376] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EHM49118.1};
MKFSHIAASVILSGFCFSAYASPTDNIAVYSTEKSNGSISIGGQSVFTKTFEVELAKLSG
DTVDLSKLCLKAYSAKNKEYKLDTIDEEIATGMLKYGRPTKGIAVFASEDSEILQATLVK
ISADCSS

BLAST