GenomeNet

>tr:G9Z9K9_9ENTR [G9Z9K9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EHM45482.1};
MKLSTVVASAVLAGFSFAANASAIDNVAVYATEKANGSMFVAGKSAFTKTFDVTIANLSS
EEVDLSRLCLKAYTADNKAFKLDTVDETLTEGKLKEGKPVKGIAVFASEKEDVMKAGLIK
LTADCK

BLAST