GenomeNet

>tr:H0Z009_TAEGU [H0Z009] SubName: Full=Stromal antigen 2 {ECO:0000313|Ensembl:ENSTGUP00000003894};
MIAAPEIPTDFTLLQESETHFSSDTDFEDIEGKSQKQGKGKTCKKGKKGPAEKGKSGNGG
GKPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFF
IQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIGV
LVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINM
DNTQRQYEAERNKIIGKRANDRLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDAI
AEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKELN
SKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAH
RPVAVAAGEFLYKKLFSRRDAEDDGILKRRGRQSPNANLVKTLVFFFLESELHEHAAYLV
DSMWDCATDLLKDWECMNSLLLEEPLNGEEPLTDRQESALIEIMLCTIRQAAECHPPVGR
GTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYT
TGRLEKHLDALLRQIRDIVEKHTDIDVLEACSKTYHALCNEEFTIFNRVDIARSQLIDEL
ADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSRWDLFGCNYKLLKTGIE
NGDMPEQIVIHALQCTHYVILWQLAKVTESSSTKEDLLRLKKQMRVFCQICQHYLTNVNT
AVKEQAFTILCDVLMIFSHQIMTGGRDILEPLVYTPDSSLQSELLSFILDHVFIDQDDDN
NSADGQQDDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDIIK
ETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSPTFSGIKELARRFALTFGL
DQLKTREAIAMLHK

BLAST