GenomeNet

>tr:H2M697_ORYLA [H2M697] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000013987};
MGYTRFAVMLLVSMVQLVSGMSFMTPEPDIPPTPARDSYPPEDLIHAALQSKKYLGQASA
GTTTNPTQAVPEFKQTESTATPLSPGFLTTSISSSSTAGQPGSRNPISLLEEETTTTLIT
TTTITTMHMPVQCNASLSAMEDVVESPDHASSSPLECTYSITVYPGYGVEIKVRKANLSK
EESLMIMGRGGSGPELLANETLMKEGQVIRSTTNQVYIHYRSLRQSNHGTFSLHYQAFLL
SCPFPMSPEGGGVTVTDIHPGGQAHFHCDRGFQIRGHEVATCVNTTQPHWSTPGPQCVVV
SCGGWIRNATVGRILSPPPSSSSNHSNGNNLTCHWLIEAKEGHKLHLHFERIALDEDNDK
LIVRSGNSSVSAPLFDSDLDDVPERGLLSESSTLYLELTADSSAIPLLLALRYEAFDDEH
CWEPFMPNGNFTSSDISYQLGTIVTFSCSPGFIMDPGSGTIECVDPNNPHWNDSEPVCKA
LCGGELSDPSGPILSPDWPQSYSKGLDCVWQIHGNEEKHIELDIRTLNISQNDVLTVFDG
RDVMSRVIGQYQGSKERFQVVSTGSEVTIQFQSDPEDAASVLNRGFFIQYREVEPNDTCP
TLPEIEFGWSSSSHSFPVRGSVLTYQCQPGYDISGSDIITCQWDLSWSSSPPTCVKVPQC
LDPGEVVNGARSVRPEAGFVVGTVVRFSCNQGYQLEGPSQISCHGRDTGTPKWSDRSPKC
VLKYDPCPNPGVPDNGYQTLYKHNYQAGETLRFFCYEGYELIGEVIITCVPGHPSQWNNP
PPFCKVAYEELLDDHKSDVSQSYEMSPQMLSENIALAIILPIILVILLIGGIYMYYSNIC
RLEWKPRFWKSLSHTHSYSPITVESDFNNPLYEAGDTREYEVSI

BLAST