GenomeNet

>tr:H2NMQ0_PONAB [H2NMQ0] SubName: Full=Ryanodine receptor 3 {ECO:0000313|Ensembl:ENSPPYP00000007144};
MAELGGGGEEDARWYRKEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHVAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDIL
CSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWY
FELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWS
GRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMSF
SAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGTT
QFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQ
HPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNLAAEEDLKKVKLPKNYMMSN
GYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVP
YALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSYA
VRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGRT
WQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGRM
NLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEEMRIDG
TMDSPPCLKVTHKTFGTQKSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEIL
SHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHES
VKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQNALPL
SAAIFKSEEKNPVPQCPPRLDVQTIQPVLWSRMPNSFLKVETERVSERHGWVVQCLEPLQ
MMALHIPEENRCVDILELCEQEDLMRFHYHTLRLYSAVCALGNSRVAYALCSHVDLSQLF
YAIDNKYLPGLLRSGFYDLLISIHLANAKERKLMMKNEYIIPITSTTRNIRLFPDESKRH
GLPGVGLRTCLKPGFRFSTPCFVVTGEDHQKQSPEIPLESLRTKALSMLTEAVQCSGAHI
RDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDDVRQILLLIDPSVFGEHSAGTEEGAEKEE
VTQVEEKAVEAGEKAGKEAPVKGLLQTRLPESVKLQMCELLSYLCDCELQHRVEAIVAFG
DIYVSKLQANQKFRYNELMQALNMSAALTARKTKEFRSPPQEQINMLLNFQLGENCPCPE
EIREELYDFHEDLLLHCGVPLEEEEEEEEDTSWTGKLCALVYKIKGPPKPEKEQPTEEEE
RCPTTLKELISQTMICWAQEDQIQDSELVRFFFDLLRRQYDSIGELLQALRKTYTIFHTS
VSDTINLLAALGQIRSLLSVRMGKEEELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVM
EVMVNVLGTEKSQSPSMRGSTPLDVAASSVMDNNELALSLEEPDLEKVVTYLAGCGLQSC
PMLLAKGYPDVSWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRG
EGGNGLLAAMQGAIKISENPALDLPSQGYKREVSTEDDEEEEEIVHMGNAIMSFYSALID
LLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDRDGIISIPLKLPSLNKDGSVSEPDMA
ANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALN
RYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAIC
NHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEE
LHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDTRITATLEKQISVDA
DGNFDPKPINTMSQSGWKYGISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLA
VGWTVERTKEGEALVQQRENEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAE
NYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGVIVSRG
MKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAK
VLLPLVDQYFTNHRLYFLSSPLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGND
STTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRT
QIKGVSQNINYTTVALLPILTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKN
IYVERQRPALGECLASLAAAIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMC
PDIPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCC
TKVTSEHLSLILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEK
LMKNAVKTVQEEQLKADGKGDTQAELLILDEFAVLCRDLYAFYPMLIRYVSNWLKSPDAD
SDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKVISAASGGQD
QERKKTKRRGDFYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVR
EHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQP
LRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPHRSINLFLHGYQRFWIETEEYSFEEKL
VQDLAKSPKVEEEEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSC
QSGEDEEEDEDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVET
LKLGIAILNGGNAGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLG
MVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVII
STVDYLLRLQESISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQ
QSLAHSRLWDAVVGFLHVFANMQMKLSQESCRSHGEKPHLKDSRQFIFDVVEGGEQDSME
LFVNFCEDFFEMHAASQISESDSADRPEEAEEDEDSSYVLIAGEEEEDGSFEPGSAFAMA
CASVMRIVSDFLKKAPLKNLTKHYRNVKNMTAKELVKVLFSFFWMLFVGLFQLLFSILGG
IFHILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGITTELV
HFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQKKRKA
QAAEMKAANEAEGKVESEKADMEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQKVEKLE
AFTANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDV
ANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVF
KREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDL
YGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSFLYL
AWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYT
VVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMY
RIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTP
HGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQY
EDQLG

BLAST