GenomeNet

>tr:H2T434_TAKRU [H2T434] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000019422};
MAGCVFPMGPESFQRFTPDSLAAIEQRIIQEEARLKKQYKEDLGDVELPQARPDLEAGKQ
LPRIFADIPSHLVGVPLEDIDPYYFRDKRTFIVLNKGKAIFRFSATSALYFFSPFHPVRR
IAIKILVHSYTLFSLFIMCTILTNCCFMAMSEPANWAKYLEYTFTGIYTFESLIKILARG
FCVGPFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIV
GALIQSVKKLADVMILTVFCLSVFALIGLQLFMGNLRQKCVRSTAHCVNDSLPANASFFC
NNKTWTSMKDFINEEENFYKAEGAKDALICGNGSDAGKCPDGFECLKTGRNPNYGYTSFD
TFGWAFLSLFRLMTQDCWENLYHQTLRSAGKTYMVFFVVVIFLGSFYLINLILAVVAMAY
EEQNQATIVEECQKEREFQVAMERLKKDQQAAAQKALDSDSVMSPELSPFALPLDHQEGR
RQSQVLVGVAEAEANLSEEKLLQVDVTDGGKPVHPLLARSFSAKTRRSSQVSSIFNFRLR
SRGSEGEMADDEYSVPEDVIEGVGGGTYSGGTFSGILSHPWPKRRPSTYSTTSRSSQVFY
PTLNINGKLFVTMDQNGVSPPPLQGQLPACTMEKVNVRHQILQAPTSTTELSTMLLPRPS
SLQGSVSRGRALSAASYLTDAMEELEEAHKRCHPCWYAFAHRFLVWECCPCWLKVKQLVK
VMVMDPFLDLAITICIVLNTLFMAMEHYPMTEEFNGMLSIGNLVFSGIFTAEMVLKIIAL
DPYYYFQTGWNIFDSIIVCLSLMELGLSNVEGLSVLRSFRLLRVFKLARSWPTLNTLIKI
IGNSMGALGNLTLVLAIIVFIFAVVGMQLFGKNYQDCVCKISKDCTLPRWHMKDFFHSFL
IVFRVLCGEWIESMWDCMEVAGQPLCILVFMLVMVIGNLVLLNLFLALLLSSFSSDNLSA
PDEDGEMNNLQIAIHRITRGLAWCRKQVVDFFNGNLKRRRQKQKEAKAMMKLKRLSSIHM
EVNGAVIGAETSEPPNVDEPQFNKSIQGLCGCSRAPNVPIAPGESDVEFPEDEDEDGEEE
EEESEASQEEEERIKGEMRSQFRPSRLSFQVSGQTDLTQLGVHNNSTDAEYLITETKTRK
SSLAANQKDEVSLSEGSTVDLRKPGEEEDEYSEMAEEAMDPENCFPDVCVARFQCCDLNT
TAGLGQMWWRTRKTCYQIVEHSWFESFIIFMILLSSGALAFEDIYIEQRKVVKVILEYAD
KIFTYIFILEMLLKWLAYGFKKYFTNYWCWLDFLIVDVSLISLVANTLGYSDFAAIKSLR
TLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRC
VNRTGHIYEAAFINNKSECEALNDTSLFYWTKVKVNFDNVGAGYLALLQVATFKGWTDIM
FAAVDSRAVEEQPIKEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKRKLGGQDI
FMTEEQKKYYNAMKKLGSKKPQKPIPRPLNSLQGFFFDLTGKQAFDIIIMVLIILNMITM
MVETDEQSPQMEYILNNINLAFIVIFTTECLIKIVALRYYFFTVGWNIFDFVVVILSIVG
IVLADIIEKYFVSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLF
LVMFIYAIFGMANFAYVKRQAGIDDMFNFETFGNSMICLFQITTSAGWDTLLSPILNNSP
EECNPNIPHTGTTVRGNCGNPSVGITFFVTYII

BLAST