GenomeNet

>tr:H2YN35_CIOSA [H2YN35] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000006737};
DPLIWNPCHVTSWLEWVVSEYGLHHIDLTKFNSVSGTELCRMNVEELTRYTTRYNSEVLV
QHLKFLKQAALHQLPAIKSEKLGTMSSPLTIEDYRAIYQGPDSSAEKLSVEGGGQIQLWQ
FLLELLSDPANASCITWEGTSGEFKMVDPDEVARRWGERKSKPNMNYDKMSRALRYYYDK
NIMTKVHGKRYAYKFDFHGLAQAIQVTNNSDRYGYTYTQTPRLPSYAESMQKSYSTTEPE
ESPSAPSFHIPTPEDPVFSQNPFAGPTPPVFTPHNPEYNERLSWSESSGYYSNGYDAPPS
AEVSSARSVSSTGGNYQESTFNFQPHNNFTPYPAHSTALIPATSTYYHTTGVGNFHAAYD
NSYTSSMASHHMTPQNMASSTTNMYTCGQEAYPSTPNGGFEQNTYFKPLESLNVDTGALY

BLAST