GenomeNet

>tr:H5UJS2_9ACTN [H5UJS2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:GAB45980.1}; Flags: Fragment;
GNAKIDEHADPKVQIQQAIEDAQRQHQALSQQAASVIGNQRQLEMKLNRQLEDIERLQAN
TRQALTLADQAAAAGDTQKSTEYTNAAEAFAAQLVTAEQSVEDLKSLHDQSLQAADQAKK
AVERNAMILQQKLSERSKLLSQLEQAKMQEQVSASLNQMSELSVPGNTPSLDQVRDKIER
RYANALGSAELAKNSVQGRMQEVEQAGVQMAGHSRLEQIRASMRGDALPSGGATAPGLQK
PATQAAPPTTEPPQQN

BLAST