GenomeNet

>tr:H8FP78_PHAMO [H8FP78] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MSDFASFMDGSPDAKTEDPNSFGSFMASVESDRSARLGSNLIAAADTNPDAHAKAMEIGR
QIGAPADAIAANLGEGERMAKLQKMREALGSAPKLAEFLTSDPDMAKLSSDDFSALTRLE
GSMTAAASFGRGVDLLQSMLYGAAEWSGEATGSKDLATWARRGRQANEAEAAAHGTRSQF
LNIGGVGDAAQWGKETLFEQLPLMSPALAGSLAGAGIGGAVGGPPGAVAGGLIGGFAPSV
VMGIGETQGQLKQKDPNAEAPVSVAVGGIAIGLLDSIVPGLIGRRLVTVLGKEAAEKVTH
EGIAAAAGALLKGAGIEGATEAAQEAIGEFAAAHGADQAVDWQGLGPQMVEAAAAGFLMG
GAFEGGAKGIEKLAERQKVAEAKKTAAALTDAVAATQESKLATRDPERFADLVRQIAGDG
QLHIPAESLQSLYQSGVIDDATLDGLDVTAQLPEALAAGGDVLVDPAKYLSAASKLTPEA
LAQMIGSTRRGATDMTMKEVEAFLADPARRKDATDLIESLSIQYEGAKPGQIVEDEVTQA
LMKTGHYTESQAKAQAVLWRERMIQRGADRGMDPDALWLEEKPRILGPAPRLPVDDIDLV
LERIRSGNEVKPPRQPVLDIFRHLGGVKPGSMLAQELAAMGITPKEAPGLFRPTGIGSAD
QVVVSEHEVLRDNQVKADNSGNGYADHDALMQAVAREWAGDPLQTQAYRDRAARLDAPVR
DLRKALEAEGIIPELATKENVLRLMERDQSADALGQEAGRVISALQEIVAGADEATVSDL
RPDLVSLGGASDVSFVWGNSKRGLEHIGRKRGASVVLQVIRAVALGKITKQVEGKKTVHL
ELDGTEAVLSLDLNGDRKTWLLTGWEIGKPDARGEVGAQSKATQNAPTFSRDDLGAGLQA
IISRGDPLFQPNGGGLRGSFDPIDDTIRLFETANLSTFLHEGGHLWLFQMVRDLGDERLR
PEARDRTVRDLQTVMDWMNVEIDVATASPGDIQAAIPVEAHEKWARGIEAYLMEGKAPSV
ALRDVFQRFSAWLIRTYKKVRNLSVKLTPEIRGVMDRLLASDEAIEQARRDSVFRVPSEL
LAVLALAERREIEQAQEQAALEAKAELQGRAMRELARERLAWWKTEREGVRAEVEADVRT
RPAYRVVALSKGIGPDGAKLIDPDTGEAQVLKLDRKALVAEYGEEIVRLLPTGVTVAKGG
VNHHIVAGWFGLPHGDALRLALMDAKANPQAEVIERETDARMRERHGDMVTDGRIAEDAA
DIVATGKAIEAVALQAKCLKRLVGDTIDKAAARRQAEQGAGSRSDDQARIDAAATSTDQV
INAGVPAEGTTAAQVAEAMAAGEAKAAPLQRTAQRAAVRQVRNILAGMDHTAIREAAAKF
IAARQVSQATDATMYRAQAKRHEKRATLALAARDYVEAHDAKQQQLLNMELERLAREART
EVEKFQAKARRLNKPDGKLAATMDEDFFRAARQVLARYGLARANSDFDTKVWLDRLEETD
PAGAEDIAAIIANLTKAPTPGQVKSRIMPDGRRVEIAPDYRDMTMAAFRDLRDGVQALLT
MGRNARSALVDGERVEFERITEEARAQLEPFQRDRDLSHMPTDTEKNRHGLLGIVASWRI
AESWARLADLGKVGVMTKYVIRPVFDAVHAYRTARREIQEKLLAILSPVRDDLAKPQLIQ
APELKDGFYFSNKGQLIHAILHTGNESNMKKLLVGWKWATLNKDGSFDRSGWASFMSRMF
ADGVVTKADMDMVQSVWDLLESTKPAAQAAHKAMYGVGFKEIEASPIKTPFGEYRGGYVP
ALTEKSLNVDGAGQEAVEALTAQQSGAMFPAAARGFTENRVENYAEPLTLDLLLLPAHLN
KVLLFSHVGPAVRQTARLLKRRDFREVVGRYDPSAIDGVLWPMLERAVRQTVETPALTPG
GRKAAEFARYFRTTAGLQAMCGNLLNAAQQITGISSAATMVGGGALARSLVTVWRNPESS
TAAIMAKSALMRERMDSSAYEASMEIEKILKDHTLLGKGQSFAQRHGYFAQQLAQNFVDR
VVWWAAYDKEIGNGTAEAEAVQQADSAVRLTQGSFSPESVAAVEAGNAWVRLFTQFMTYF
MAQGNMIATEVMIALRTMTGGNLSRRLAGVYVFAFLIPAVVAEAIMQAGRGELGDEDDDG
WLDDLASLFLLPQLRFFAAMIPVAGPVAMLGINALNDKPYDDRLAASPAVTLMESAGRAA
VTTAKAVAGDGDKSRAVSDAMNAVSVATGIPTGMIRKPASYAVDVAEGDSRPRHLGNVVS
GILTGQDGTAR

BLAST