GenomeNet

>tr:I0QRX2_9GAMM [I0QRX2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EIC84045.1};
MKVYTIVLSLALSSICVGANATTLDNIGVYSTQESQGSVSIGSKNAYTKTFEVVLANLSG
ESVDISKLCLKAYSKDNKEFNLDTVDEKLTSGMLKYGKPVKGNAVFSSDNDEVLNAALVK
ISDDCN

BLAST