GenomeNet

>sp:I3J958_ORENI [I3J958] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000005398};
LRTGRTQRIKHKFKYSLKMKFQCVLEGISKARNPTHLNQIYTELNITDGDTTEVNNEHEV
RQLETSSRKVDRPETTIKREDIFKGLPGKKEVIRTVLTKGVAGIGKTVLTQKFTLDWAEN
ISNQDIQFTFPFTFRELNVLKEKNFSLVELVHHFFTDIKKAGICSFDEFRVMFIFDGLDE
CRFSLDFHNTEILTDATQFASVDVLLINLIRGNLLPYAHLWITTRPAAASQIPPEFVDMV
TEVRGFTDEQKEEYFRKRFKNEDQATSIVSHIKSSRSLHIMCHIPVFCWITATVLDDVRK
TREGAELPKTLTEIYIHFLVVQSKVRKIKYHGDAETDPHWNSESKKMIESLGKLAFDQLQ
KGNLIFYESDLMECGIDIRAASVYSGVFTQIFKEEXVFCFIHLSVQEFLAALHVHLTFIN
SGINLLEDQLKMPLLSKLFKSAIDKALESPNGHLDLLLRFLLGLSTQTNQGLLRGLLTDT
QRHFESNQETIQHIKKKIGENLSAEKNINLFHCLNELNDRSLVEEIQQSLRSGSLPIDKL
SPAQWSALAFILLSSENDLDVFDLKKYSASEEALLRLLPVVKASRKAVLSVCNLSETSCA
ALSSVLSLQSSSLRELDVNNNNLQDSGVKLLVIGLKNPHCRLETLRISGCLITEEGCASL
ASALTSNPSHLRELDLSYNHPGDSGKRLLSSGLEDPRWRLQSLRLEPAGVQWLRQGLRKY
FCQLTVNTDTVNRNLKLSDNNRNVTYVKENQSYPDHPDRFDQNHQLLCRDGLTGRCYWEV
EWSGGVHISVSYKRISRRGERNDSWFGGNPQSWSLFTDGGYSIWHDTKGTSIPSCSSSSS
VSGRVAVYVDCPAGILSFYRVSSDELIHLHTFNTTFDVDEPLYPGFGLWSWSYLSLASSV
RLCSL

BLAST