GenomeNet

>tr:I3KBJ3_ORENI [I3KBJ3] SubName: Full=Inositol 1,4,5-trisphosphate receptor, type 2 {ECO:0000313|Ensembl:ENSONIP00000018488};
MPEHRSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNNTQGDLFKKLQHAAELEQKQNDSENKKLLGEVVKYSS
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPAGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKVTLFMKFSDYRDDVLKGGDV
VRLFHAEQEKFLTCDEYKEHQYVFLRTTLRQSATSATSSKALWEIEVVHYDPCRSGAGQW
NSLFRFKHLATGNYLAAEVNPEFIPKTVETKGDVNQNETDIVYSKKKNQAAERIAFTLVS
VPHGNDISSLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNVPIDADEERPVMLK
IGTCSTKEDKEAFAIVSVPLSEVRDLDFANDANKVLESTVKKFSNSSISQNERRFVTKLL
EDLVYFVCVVPNNGEDVLSVVTSTPNRERQKLMREQNILAQIFGILKAPFTDSRDGPMLR
LEELGDQRYAHYKYMFSLCYRILRHSQQDYRKNQEYIAKKFTIMQSQIGYEILAEDTITA
LVHNNRKLLEKHITAREIETFVNLLRRNREPRFLDYLSDLCVSNKTAIPITQELICKFML
NPSNADILIQTKLISNIETSNLESSLMQEEGEEEEVWLYWIDSNKEPHGKSIRHMAQDAK
ASHKCDAEIITYYRYQLNLFAKMCLDRQYLAINQISSQLSVDLLLRCMYDDCLPYNLRAS
FCRLMLHMHVDRDPQESVVPVRYARLWTEIPSKINVNEFEYESTDSSTEEMKKKFAPTME
FVEEYLKDVLNQAHPFEEKAKNELTLEVVNLARNLVYFGFYSFSELLRLTRTLLSILDFV
QYPASPLNKLSKGPEAGGNNVLRTIHGVGEMMTQMVMSRGVPHILPDSPPSLRYGKVLFL
PENEDLMVMDTKLKIIEILQFILSVRLDYRITYLLSIYKKAFGDRALTDSSMSLADMPPM
TLLSSACEPDIDEIVQKAESMFVESSELSAVELDGEDGRTFLRVLIYLIMQDYPPLVSGS
LQLLFKHFSQRSEVLEAFKQVQLLVSEQDVENYKQIKADLDQLRLTVEKSELWVEKSVVY
TGEELAAKMAKEPNAEEAVLSPVQDGENKPQIDSNKANNYNIIKEILLRLSKLCYGNKKS
RVQQQRLLKNMGAHTVVLDLLQIPYEKSDDKMNDIMTLAHTFLQNFCKGNHQNQVLLHKQ
LNLFLTPGLLEAETMRQIFMNNYQLCNEISDRVVHHFVHCIETHGRHVQYLRFLQTIVKA
DTKYVKKCQDKVMTELVNAGEDVLVFYNDRSSFQVLLQMMGSERERGDEYGALAYHNTLV
ELLAACTEGKNVYTELKCNSLLPLDDIVKVVTDVTCIPEVKTAYVNFVNHCYVDTEVEMK
EIYTSSHIWKLFDNFLVDMASVCNTTTERSHADLALEKYVTETVMAIVKGFFSSPFSVNH
SNLQTNQSIFIKLLQSAFRIYNCTWPSSAQKANIESCIKTLADVAKARSIAIPVDLDSQV
NTLSLKVHSNMVQRAAKDWRISARTRPRKEPLGGPDYKNIIEKLQGVVSHLEEQFSPKVQ
AEFSVLVDVLHSPELLFPEPARLRCEGGAFMSKLIKHTKKLMDKEDKLCLKILETLREML
EKKESFEQSGNDLRKILLTRYFGNQKLLSKSELGSGNSSSGGFVKQSPGGGSPMVDADKP
ATSVSDIQCLLDNVGATEMVIELIVNTKNDRLFTESIELGIALLRGGNTQIQNSFYSQLN
KQKKSERFFKVFYDRMRLAQQEIRATVSVNMFEVSCRKRDDDSDVSSIRVKKGKDSGLHM
RDDMRGQLKEASSVTSKAFSAFRKELDPDLEGLGQNSEIIGTEEALEDTQMSPAVSIMKP
ILRYLQLLCENHNSKLQNFLRSQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEF
NVDLILQTLETITEYCQGPCHENQSCIAKHESNGIDIIIALIVNAINPLGKDRLDLVLQL
KNNASKLLLAIMESCHDSENAEKILYKMRPTELVDVMKDAYKQGLQSEDDDDGMGDEIKP
KDVGHNIYILAHQLARHNKILQQSLTPGSGLGLGSGMDHDKEKDDALRYYAKHTAQIEIV
RNDRSMEQIVFPVPNICEYLTEESKMRVFTTTERDDQGSKVNDFFHQFDNLYNEMRWQKK
IRKNKALFWFSRHISLWGSISFYLALLLNIAVAVFYPFGDDEDEGTLSPFWNILLWVALG
VFTALLPVLPKPIGIGFFLVSLILRAIYTMGLGPALLLLGAVNLFNKLVFLVSFVGNQGT
FTRGYKAVVMDMLFIYHLWYAIICVLGLFVHEFFYSFLLFDLVIREETLLNVIKSVTRNG
RSIFLTAVLAVFLVYFFSIIGFLFLKDDFRMEVDRLPSPVLVGKRDLLSNSEVAGSCLKD
RCPASTPTSVPVGGGDEDDGTERVCDTLLMCIITVLNQGLRNGGGVGDILRRPSKEEPLF
AARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTSCFICGLERDKFDN
KTVSFEEHIKSEHNMWHYLYFMVLVRVKDPTEYTGPESYVNKMIAEKNLDWFPRMRAMSL
VSSEGDNEQNEMRSLQEKLENTANLVAQLSGQLAELKEQMTEQRKNKQRLGFLGPPQPNH
HIPTH

BLAST