GenomeNet

>tr:I3TPU2_TISMK [I3TPU2] SubName: Full=Transcriptional regulatory protein {ECO:0000313|EMBL:AFK54780.1};
MPPVPLATSPRKRPVQARSRATVETILDGAAHILIRDGFDRATTTRIAEAAGVGIGSLYQ
YFPSKEAVVAALIDRHAAALTRVFDDLAPRLAGRPPAEAVAMIVAAATDAHRLHPALHRV
LNEQVPRIGDMARIRDVSATITSHVARWIATLPLAPGRDPAILAVLVERSIEAVVHGALA
DGHDRLPRALHDELVTMLARHLAPDTPRQDQRISKAS

BLAST