GenomeNet

>tr:I4BY88_ACEMN [I4BY88] SubName: Full=Small GTP-binding protein domain protein {ECO:0000313|EMBL:AFM22245.1};
MSCHGLFGKLFEKHGRTKENTVPRDNEIFHCGEFHCSECPLASRCSMKSEGNPPNSTLMD
KKLKRVLLMGNPNVGKSAIFSRLTGLHAISSNYPGTTVGFLEGSVVINGETYKLIDVPGA
YTLDPTNEAEEVALRILNEGADIVIIILDATALERNLYLALQVLEKGYPSVIVLNMIDEA
RHKGIQIDLKALERELGVPVVSTVALTGEGIAALKAALPKARPSFLLPMTKDERWRFIGD
IVMRVQMVTHRHHTFRDRLEDISVHPLSGMFLSLLVIIASFYAVRIIGEGLINYLLDPFF
NSIWGPFLNVISNVLGGSGFIHDILIGHLIDGSINWEQSFGILSTGIYVEFAMVFPYIIS
FYLVLSLLEDIGYLPRLAVLFDALLHKIGLHGFAIVPTLLGLGCNVPGILATRVLESERE
RFIAATLISVAVPCAGLQAMIFGVIGSLGLVYIAIVYASLLGVWLILGYMLNKTLSGQSP
ELIVEIPPYRLPSLRNLGFKLWFRISGFLLEATPLVLLGILIANLLYSSSVLPFLSNILS
PLVKLLGLPPQAMGAILLGFLRKDVAVGLLLPLGLTPRQLVVATVVLAMTFPCIATFVVL
FKELGLKRLIQSVLIMISISLITGIALNYLLSYLAI

BLAST