GenomeNet

>tr:J2TGM5_9BURK [J2TGM5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EJL77567.1};
MPKAPAKPSNATNKHLLAELKNIAEGLGKTFAPFCEVVVHDLTHPKNAILAIENNLSGRR
VGQPATELGLARIQDPDYPAVIANYANQFADGRKVKSTSVGIRNEEGDYVAAICLNVDLT
LFNGFQAAMSQFTAIESSAVTETLDAANADRIQQCIDEFAAARATTARSLRPADRKQLVQ
DLKKAGYLEIRRGAEIAAAHMGVSRATVYSDAK

BLAST