GenomeNet

>tr:J3C908_FLASC [J3C908] SubName: Full=Periplasmic protein involved in polysaccharide export {ECO:0000313|EMBL:EJL66719.1};
MTKNGFYLLFLISTLFTSCIPVKDLVYLQDKGASGNETTVSAVESKPYRLQVNDVLSVDI
KAIDPKLVAIFKPSESATLGNNDKSESGLYFNGFTVDDHGNIRMPILGEINVIGYTLEEV
RLKIEKKLQEEYFKAEANIFVTVKLAGFRYTINGEVGSTGTKTLYMEQVNIMEAIANAGD
ITTVGNRKAVTIIRQTPTGVQINDIDLTDVNVIKSPYYYLQPNDYVYVKPLKQKTWGTGQ
TGIQSIGSIVTLLSLATTIYLLSKN

BLAST