GenomeNet

>tr:J9J0J0_9SPIT [J9J0J0] SubName: Full=Cation channel family protein {ECO:0000313|EMBL:EJY78675.1};
MIIIANSISLALDDPLSTKTQVYQQQLDYIFLAFYTLEMIIKIFGSGFILNKGSYIRDAW
NFMDFTIIIFGFLSIFATASINISSLRVFRVLRPLRTITKIEGLRTIVTALITALPLLRD
TIIVLLFFFIIFAIAGVQLFSGYLKYRCVDVETGIPNYDLFCGSQICPKTHFYSDGSYDP
EGSKYFCGQTNRNPNYGSTSFDNLLYALLVILQSVTLEGWTPIMVTLGKTLSPMAVLYFF
PIVFIGAFFLLNLTLAVINSKFNDAHKEQQKKKKILKQAGSIKQETEVKNAAASTENNSI
KRYLVAKRAARKMVTFMQKKKLSPNVIAGSQLFSENQIDNFSESSFMPNNLAKEPYRDDS
GEISLRMSRNAPQFDSRSFETTEQNFQNQIPTGSNPLINRILQQRQDQSLLLSNRQDEQG
INSNQQMKRLKKPMIKNPSQKELIQQNRQPPQYSRAKILRTPHSYYKDLRTVKAIKMLLG
KLSIKVRWQSSNLYQLADQESLKLIVNIITSRLETYIKKVELKRRSKMVGFDHKTQKIVI
NQAAKYQSASELDVLEKRNQSNDLKMQLQEKNNKKQTNTSSQPYQMRVQYELHRESDEDE
EYIQSAIKKKEFEQLEPYQFVNSIHHQQNLKNVPISDITKKSNLIYTGSLSLIIQKRNQQ
SQVQRTVKKNQDEKLKRSKTLTNQTLNHRDSGASRKIGVSISQISQPSLAKSQKIQVAGQ
RRGAISTNFENQPKNESTIQKSQLQQVAKESKSQLPNDNQKPFSNFQNLDRSIDSDRQDF
MNPISKIKRGQWSGQDVMNGMNLQRAENILDRLNNIRVFPKGAYGKMSKLQKMIKSFVKS
NFIENFMTICVTMNTITLAIDRYNIPQDQSRLLIIFNNIFTGIFGFELCTKILGLGIRSV
ISRSIQSFAYIALLLILFIFIYSLLGMQIFGGFYQFADGKPRSNFDSFNSAFILTFQLLT
MENWNTFIYDALRSEVNEFITIIFFVSWIFIGNFILLNLFLAILLDSFLEEKEEEDELAL
EEELQGINQTEQDQHVQTMESQNRSKVHQKSLLQNKKRMKQLIRVNTKSEKPKQSILSLI
SEGLKKNLESDSAELQNEKFEEMDEKQIQIFLRRYRIVKDQDEIDLILQNIGCQKSFYIF
DRKNKLRVFCYRFVTHPDVVKEVSMNLDTVFSILFAFEAIIKAIAFGFVQDEYSYLRESW
NVLDFFIAVSSIIDLILIDVNLPAIKILRLLRTLRPLRLISKTSGIKTLVICLLESVGHI
INVVIVLLIVWLMFAILGVSLFSGKFFYCSTNPYLNHNEMICEKDRGTWQVYDSNFDNVP
NALETLFIVSTFENWITIMFQAIDSSFENQGPQEDSNMFSAYYFIFFILIGTYFFLNFFI
GVLFLNFKHAQKNEAGGNFFLSLQFCLDFVEEEIHWIDMQKMILKASPDYETINVPKDWF
RSKVHQIVINNIFDIFIMICIILNMLQMAFYFEGATLAYVRVLDSVNYVFTAIFTLEAIM
KMIAFGRRYFVLDWNKFDFFVVIASILDITLNLLNNINSKFLRIGPQLARVLRVLRVSRL
FRLIGKSKGLQALLQTITFSLPPLFNAFSLLMILFFIYAVLGVFLFSNISSGKIINDDFM
NFNNFGNAMIILLRVLTGEDWNNIMFDASVDIGHLIGSIYFISFRLIGSDVMLNLFILII
LQQFDQYYLPQENVIQKFKDNLEYFKTTWKKFSIKYGGLKIRESLLIKFFQSMNEPLGMP
DSNEKEINKEIIKMGIRSEDGWVFFNELLYRSMKRIYGDKDFKSDIMIITEFQTLFKIHQ
INQALIGKKKLFSKKVNQYKDMALNRQSCNPFQQLYYFQLSFKVWREYSTKKLKLGLNQS
EKEKKSADDYYEHINKYIQNFRDEDPYFNDRDSNYSYDSFYESLKEEESESEEEIPISNS
RFSFINPRIIVSNAGVKKDTNLRSTLEEVQEEKSLDIQQTIQSQVQLKGLFRRESSRLLP
KQSSSNLLFNDKKSAHKTSNMSLLSKNSKSKSFYEANESSSNNEIHKEQKHLKIRQELLK
IQNEINNQEIKDSTPVNNKLERLMTGQEDFNNINQKRKLSQSQPRKHDI

BLAST