GenomeNet

>tr:J9JY48_ACYPI [J9JY48] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblMetazoa:ACYPI005354-PA};
MAKAKETKINMPEPSSYSFKDELTAQEEHFFALVESCNMPAIEKYLETNSLNINMKKQGY
TPLHLAVQKQCEPLVELLLRQKGEYIHYITASSTNVKIGDLMLLAITYDNLKMLERMLEF
DEANNKSGNRGRGNGWNRIRSNDDVKGHYPEIYIDSEEFPRFMTPLMLATQCSLYETVEY
LVNRGHKLDRPHPPRCTCSDQCVAAATRGDVVADSSERLNGYWSISDPTFMCTTSSSSDP
VLECFRLYEELLQCGSTEQVHKTTYTQMATQVRQFAVEMIVNCRTSDEVKIMLRNRDGCR
FRGKFPYPRLITAMDYKQKEFVAHTNIQQVLETAWLGDWIEWKSYSATWKLLYLLRRFIM
LPAMVILGMLAPNSKMNQFNRLPINRMFNSLVTYLVFLWLLFRQSNADKFETRRGAPELG
MLLPIAVFVVGHVLEKLKLRLQQGPERFFKNLWNVFDTVKLTLFSLAFLSWIAAALNIIT
QGSDDLDRKYWPWIDPQLVAESLFTMATVMAYLRLLFLCQLNYYIGPMQVSLGKVLHDFG
KFATFLLIIMAAFTCGLGTYYSYYAGMVHKDPETGETTRQEDSFITVADTFKTLFWGIFC
MTSLEAPNVVVTNTVAATGHIDAATQSHQFTQLVGYGLFAVFEVLMVVVMMNMLIASMSD
TFQGVTDNAEYEWLFGRTQVYVSYMLLNDMPPPFNLLPTTGLLFCAKRLVSNSSHGYSRM
PGDDGRGDLDSRSTAEDPEFRNLMTEIIKRYFTMRRPLVER

BLAST