GenomeNet

>tr:K0ZJ08_9ACTO [K0ZJ08] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000256|ARBA:ARBA00018893, ECO:0000256|HAMAP-Rule:MF_00377};
METPSLNAAWTQALELLAQTGLGPAGMGFLQSTRPLGNIEGTILLSVPNDFTKNWIERSS
SSVTDALSQTFGKRTRIAITVDPDMELPETADEKEHQAKNVEVASSTEDNQPTTNEVPSA
GHHQTGDTPTYAQSFSYPSAEERLRQLDGVEAINDFPDSSFEEHDPKRFSYVAPQSTDRA
LDTSSTRLNPKHTFDTFVIGPSNRFAHAAAVAVSESPGTDFNPLFIYGESGLGKTHLLQA
IGHYTLSLYPNQKVRYVSSEEFTNEFINAIRVNNPNNSAVEEFHRRYRELDLLLIDDIQF
LSKKEQTMEGFFHTFNALYQANKQIVITSDVQPKHLEGIEERLRSRFGSGLLVDVQPPDL
ETRIAILQKKTADENLDIDPEIFTYIAERISSNIRELEGAILRVVAYANLYHEKIDLALA
EMTLKDYISDPDDTEITIPLIMGQCAKYFNVTIDQLCSTDRSRAIVEARQIAMYLCRELT
ELSLPKIGQSFDRDHSTVMHANKKILEQMKQRREVYNDVTELTNRIKKVARGGN

BLAST