GenomeNet

>tr:K3UTA4_FUSPC [K3UTA4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EKJ75721.1};
MDSNSSPAPDPDATTRRRSGRVVRAPSKFTPEPASQPTHPKRKRDDQDDEDDDGEEEEAA
AENEAPDSDEEMSDEPDNDSDEDHPAPRSRKKASQTSRAKKPSAKKPKINGSKPLRPARV
THTAKSLPSRPKKSVRIEDAAVKGTGLYSDLFGSGDSSKSVAEEWLNKYNDDGAAAFTDL
VNCILQCAGCGQLITEDDVRDAENIAGRLADLQSVYQEQEITDYPLISRTKQSRSFRDVL
ITFFENLIVNMHQNNLMYRDEFLIENLHAWLASMSSSSLRPFRHTATTISLAVQSALVEV
ANVLDTRLGRAGKARNSKVKMTAAMQRDVEKSTSNRKVCSELIQSFFDTVFVHRYRDVDP
RIRTECVEALGNWIISLPALFLDPGYLRYLGWMLSDTHAPTRHEVLRHLAKVFRRDADTL
GHFIDRFRPRLVEMACKDADVSVRVAAIAVIDVLRDKDMLEGEEVDAIGKLIFDNELRIR
KAVVGFFVACTKDAINEKVKSLGDSDIMEEIPKGKKVSLDVPRAEWVDLKCLAETLAIYD
SQIEEEQSNQVLGLDAAVDLLEAAVPETRISLASQVLFEKVNEIKQWTLLAGYLLFDHTT
SSKARSKGSNPELAFKKAVAPTPAEEAILLDVLSSAVKSSLTHSGDHDRSRKKHQAPKDA
EDVSISPEDTATELVTVIPHLLSKFGAEPGTAAIVLRLAHFPDIEVFKQLRQNTNKYEKL
LDGIVTQFNRHDDKRVLSEAAAALLHSRRYDELEEVTDSKISSLWESTVTALHNFDKTYE
LSSRGNLEESPLKELSTVLLKISKLASLSNCVDILEAEGDSTESTTTPVIQILANIVHRG
KYEPLDDQDIDDLEDEVVSYAIKTCQFYFMWKALAYNTLLSSGLNIADAELDRLSVLRQT
FRRHLIETLSSRAAIDQLRLFATGSLCDLHLTFATLRPTIERVRPASSPGSPSTEGEKYK
ALIQEIESGLIPELIAIFDGAEKLYAKKIKKDKLLNEPAEDEDPIADDEEEEEDDEDESL
SEEERLAAELKAEKALCELTAKYVLVITARLVDNKGTHAGKLRRRLLRNQNKLGHNFKEV
VTYLDEEKLAERTRKKAASTHPTTSKSQKPQLSEALVVEDDDIFDSTPPPEEGSREDLRQ
KGLLEDDPIEDDDEDEEAERPAHESDNEVIGD

BLAST