GenomeNet

>tr:K4NZ44_9CAUD [K4NZ44] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AFV50631.1};
MIQVPELLKPVDSSAIPQPETPPSKTTQLADAARDFAQSQSQDFVHSMETVSNISPDAYA
KATAVSRYSGVPAKVLHDNADRMNQLLRGNQYAGIYTNYRKTANALRDGNLAAVSQDDLD
QLVRIEGAASDTRFNQQSTGEKLFGAVRQQWVAQRQAGRVADAARLNDIQAQFDRVDLEV
ARAAEAGEQPFPGGDNPTGFGFDYLQATPEQRQQMRERLVGRQTEQLQRAAQDEQTLSDM
PVDPGARRAAELESLGRGSLSATAEALAENPGYAFRTSVGAAATSAEMLAAGAIAGPVAA
AGIGFSGEYQSKLLDVLREAKVNPNDPKAVLRALQDDKLMADAERRASLKAAGTTAVDLV
SMGLASNLLVPSRIAGRQLTRTQRELANLAVQFPVQGIGEGASEAAGQFAAEGKVDAGEV
LLEAVAGAGMSSLDVLAFSNRRLIEGIGDGLRRARETREGQLSLDEMVDASLSSKTRGRE
ADTFGDIAKAQLADTPMETLWIPAEALTRLNQDGKANLPELMLSIPGMTEQFADASARGG
SVAIKTADYLRVFADYHQDLSQSIRTQADGMSPADVEAWTADQEAQLDDLGKIVQQNSPE
TNAYREVVDDLVASGYRRADAEQYASVHLSVLSNLAERTGQALEQIRQQFPLTFTADQAG
PQQGRRLDQFAGQTAWSADMPSLADAEQRIADGDNAEQVRRETGWSQGADGKWRFEIDDS
QAQFAPINDWLDDAEVDGVTLGEALNHPALFAAYPELAQVQIRVNPARRSGGMFVSQPGR
GFVGSYIEIGDPTLYSSDSPAIDVVMHEVQHAIQVREGFATGGSEDAMRADKDQAMADRD
YWRQVADLRREIDSLGEEAGRQAFIDTFERTPTEQQMQDALATDLPQIEQRAADAEQVMR
DIGNPETTYRRLAGEVEARNTERRRTMTAEERQAASPEQTADTPSDQAIVRWNGTEMNSA
AVAGQRLLNQNDNGDARGFITFTPRGEGDRRFQISLGDKRDLSTVLHELGHYYLEVIDQI
STNENAPEQIKDDVSTIRAWLGAEEGDPITTEQHEQFARGFESYLAEGKAPSPELAGAFA
RFKRWLIQIYKDLRRLNVTLTDDVRRVFDRLVATDEQITAAEQVTNALPLFADAAAAGMT
EQEFVAYQNSIDLAHADARDSIEEEIVREEERRRSKWWREESSRVRDEVTEEIDTLPEYA
ALKALRKGQMPDGTDLTIKLNSGELAERYGAKATRKLAFTHARDGQPLDVVGPMLGYDSG
DQLVKALLGAEPRSQVIKRETDQRMLERHGPKSTGEAAERAIDATHNERRAEVLQKELRR
LAQVGNRKNITTQQILKEASRRVMLQRKVRDIQPAEFQRAEAKAGRQSYEAFVNGDLEAA
YEAKQRQLLNFYMYREARKAREQVEDITARMLKYNKASTRERLGKAGHDYLDQIDAVMEQ
YEFRKVSLREVDKRKSFAAWYADQLAMGNEPIVPEFVLNTSQRVNYKDLSLDQLQELDEF
VANVNHLASTKNKLLANKRLKDFEEAKNNLIRAGYANLEKRTPPPVDKNTRTLLERIGDQ
AGELSAALIKMEQVVEWLDGGQVDGPWSTAFFQPFVEAQGAKDQLNRDIAIKMTEIVDAY
TKERGAKVMQQKIHIQSLGQPLTMNAILSAALNTGNASNRKKLLDGGHNGKAWTEQQLNE
ITGNLTKRDWEFVQSMWDLVEELWPSIVQLEKDLHGVPPEKVEATPVVTQHGTFRGGYWP
LVYDTSSSAYAGVQNELGNEGGLFEQGYARATTPKGHTKARVDSFAAPIQLDVEIIASHL
GQVIHDLTHRKAIRDAAKIIGDKQIKQMLIDTLGPAVANQFNPWLQGVANDMVLDSQKGI
DAWTRGAERLRANLAVGFMGFSATTGLQQILGYSQSFEYFSKVGGKRYIFQGMQEFIRHP
FESIEMVNQMSSEMRFRVDNLDRDMRGVLKKISGKSDWLSFVQRLAFKHIGVIQAMVDYP
TWIAGYRHGLDSGLDGEQAIAAGDRAVRLSQMAAGPKDLAAVQRKDGLMRALTIVYSYFN
LLYNRTVDIKRAFSSAKGAADYLNVFERTMFLIAIPAVIGPLVSGQGPGEDEDWRAWASL
KIATYPLLGIPLVRDLASSLESGWAYKGATPIGEVFNTLSKAGAAGKSAAEGKDVDTARA
AGLAIDTIGYSFGLPVAQPKRTVKYLIGVAEGDIEPEGVTDWTRGVIFGPPKK

BLAST