GenomeNet

>tr:K6BZG8_BACAZ [K6BZG8] SubName: Full=Cytosine/purine permease NCS1 family protein {ECO:0000313|EMBL:EKN64310.1};
MSQKLENMMEDYSLEAVPAEMRRPWKDLAAVGVGIGSSLAVLLTGGLVTFMAGFWMGMLA
AFIAFLVSTFFTISLGVISFRDGFSSNIISRAYAFGTRGSAIGSLIWAFMIIGFLGMESV
LIGNSIFFYFDIEPTFTIKLIFYLILTAIWIVLSLFGNKLVSRVAEIMIPLLFLMLLFMV
FLLMKQGSLVEAVTHGILVPNMTTSQGFAIALNATVVLAGLLAIVVADFTRFSKSTKDVV
KVSVASNFSLFGVTMFFGAVITYFGYQLTNDYFLKQGMDPAAAGMAAITNPGITLVLAGG
FWGLLTIIFSQSKVQVGNSYEGALALVNLFDTAFNWRPGRAVMVVLANIISLIFIFGNIL
HYIEAFLTIGSVLLCVWVTIVLTDYYVVRGTLKFGQKGIVNLDDIPAVNWIGLLTLVVST
FTGMAFYQQNWFQVPFIISTVCAFVLYLGLNYLKSQFTSSKKNNLNNISG

BLAST